Bacterial taxon 243277
Locus VC_1075
Protein NP_230720.1
hypothetical protein
Vibrio cholerae O1 biovar El Tor str. N16961
Length 180 aa, Gene n/a, UniProt Q9KT30
>NP_230720.1|Vibrio cholerae O1 biovar El Tor str. N16961|hypothetical protein
MKARHLLPVLAAAITFPALSSPVMTLTSQDIQEGSRMAKHFVFNGFGCSGDNLSPQLSWNNAPKGTKSFAITAYDPDAPTGSGWWHWVALDIAADQHNVARGAAKQLKGVRELNNDYGFSGFGGACPPQGHGMHRYQFTVWALPFEKMEIPQGASNALVGFMLRANALEQATLTATYVNE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | 3.21 | 0.016 | ○○○○○ 1.89 | 1.8864118109359016 | 24331463 |
Retrieved 1 of 1 entries in 15.8 ms
(Link to these results)