Bacterial taxon 243277
Locus VC_1323
Protein NP_230967.1
hypothetical protein
Vibrio cholerae O1 biovar El Tor str. N16961
Length 160 aa, Gene n/a, UniProt Q9KSD5
>NP_230967.1|Vibrio cholerae O1 biovar El Tor str. N16961|hypothetical protein
MILAVPSRHGVPFNHFAKAPSFSVIDSNTQQLQTEFHLELDPSKSCGKKSAILHQLRHYQIEGVAVSQIGQSMLQALFNAGIRVYALPRGVALTDLVLTQLQPITDLSYGKASPNKVHGERGCGKHSSNPSGSRNTFVSPSTHLFQRGFSIKRLWKGEER
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -4.21 | 8.0e-12 | ●●○○○ -1.54 | -1.5372077636495032 | 24331463 |
Retrieved 1 of 1 entries in 2.4 ms
(Link to these results)