Bacterial taxon 243277
Locus VC_1487
Protein NP_231128.1
hypothetical protein
Vibrio cholerae O1 biovar El Tor str. N16961
Length 80 aa, Gene n/a, UniProt Q9KRZ6
>NP_231128.1|Vibrio cholerae O1 biovar El Tor str. N16961|hypothetical protein
MITLYSTEGCHLCEMAYALLNEVGLTKQVDVVEIAFNDELFSRYAVTIPVVAYQGNELNWPFDIQELREWLKHNGINYHP
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -5.87 | 6.8e-7 | ●●●○○ -2.3 | -2.3035752076578704 | 24331463 |
Retrieved 1 of 1 entries in 26.1 ms
(Link to these results)