Bacterial taxon 243277
Locus VC_1495
Protein NP_231136.1
hypothetical protein
Vibrio cholerae O1 biovar El Tor str. N16961
Length 238 aa, Gene n/a, UniProt Q9KRY8
>NP_231136.1|Vibrio cholerae O1 biovar El Tor str. N16961|hypothetical protein
MHSMPTLTKNVRRSAMKWIFTCVMSLLFTASSPFLSANNLSRADLTQFDQPLLLGDWYLLNPNPEQSSENFRVIKLSLASDYHFSIDIQKKDFSVDHWNGAYSADEKTLILGLDSSDPQTYQYENNHHLLTLNGVTFTKGLPNTLAGSWSSAHIKDLDGENLDQSLIQLTLQPDFIFSFHITNQDGNEATHRGVYYTEGNRLVLLYSEGEHDTRYVLDQDRLTLEIDDSMTVVMNRVQ
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -7.33 | 4.4e-10 | ●●●○○ -2.98 | -2.9768057339966054 | 24331463 |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)