Bacterial taxon 243277
Locus VC_1575
Protein NP_231215.1
hypothetical protein
Vibrio cholerae O1 biovar El Tor str. N16961
Length 152 aa, Gene n/a, UniProt Q9KRR1
>NP_231215.1|Vibrio cholerae O1 biovar El Tor str. N16961|hypothetical protein
MSNTHQGLKAVAILESAKGIVSLLLGLGLHHVAGDSLQLLLLDLLQHLHLNPASYWPEKLLHQAGLFTHFNLNWVAAGALVYGAIRLIEAYGLWHNLLWTEWFALLSGAIYLPFEVYELFTHPGVFSMAALLINLVIVLYMYRIIRSKVPQR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -3.32 | 1.1e-8 | ●●○○○ -1.13 | -1.1258225937156934 | 24331463 |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)