Bacterial taxon 243277
Locus VC_1708
Protein NP_231344.1
hypothetical protein
Vibrio cholerae O1 biovar El Tor str. N16961
Length 228 aa, Gene n/a, UniProt Q9KRD4
>NP_231344.1|Vibrio cholerae O1 biovar El Tor str. N16961|hypothetical protein
MLYSLISVFAPMLLGAQIILTLVLVKGEICPGQRGRIHKVLPALAVLWLAVASIKIEAFLVVFALFYFYSQVQTKKTREEGPLWVMYLANGLALAYVGILISEAPAWPASLTIFAAIFLLGAMLGHLLLTLARSRLQAFHRILPVVGIVSAMLTALCLLPYVSGLNDEQLQTLLMPIVMSFGLLITGIVAWCWHLISGKTVNKWQLLLAGLLVLASATGFHGLYQMPL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -5.13 | 4.9e-8 | ●●○○○ -1.96 | -1.9630958124254525 | 24331463 |
Retrieved 1 of 1 entries in 1.3 ms
(Link to these results)