Bacterial taxon 243277
Locus VC_1981
Protein NP_231615.2
hypothetical protein
Vibrio cholerae O1 biovar El Tor str. N16961
Length 183 aa, Gene n/a, UniProt Q9KQL7
>NP_231615.2|Vibrio cholerae O1 biovar El Tor str. N16961|hypothetical protein
MNLYLLLLAISLLSLSLQWPPLHELTLWHFSAIEQGQWWRILTGNFAHTNFAHWAMNLAALWIISFVFKPTARQLLIPLLLISLAVGVMILASDMQSYVGLSGTLHGLFAYYALNEALNGRRSSWLLVLGVIGKVAWEQWFGASASTAELIGARVATEAHLAGLVGGLLLAAGHCFLQRKLSQ
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -7.61 | 1.5e-12 | ●●●●○ -3.1 | -3.1045717839492517 | 24331463 |
Retrieved 1 of 1 entries in 0.6 ms
(Link to these results)