Bacterial taxon 243277   Locus VC_2434   Protein NP_232064.1

hypothetical protein

Vibrio cholerae O1 biovar El Tor str. N16961

Length 148 aa, Gene n/a, UniProt Q9KPD6

>NP_232064.1|Vibrio cholerae O1 biovar El Tor str. N16961|hypothetical protein
MSQLTVKKPYHVDLPELMRVYETNYAKLNALLPAQPEVGEVRCYQAAQMTYQLQVLEVTKYTTLLEVCQSDDLSVFPLPTMSVRLYHDARVAEVCSSEQLGRVQARYDYPNENMVQPDEKAQLNRFLGDWLTFCLKHGISRSPITLSQ

 

Show protein visualisation   Find similar proteins   Download Table  
Host Tissue    Time Post Infection Transposon Insertion Site Raw Fitness Score    p-Value    Fitness z-Score Reference  
Rabbit (Oryctolagus cuniculus)small intestine BTO:000065118 hnot available in this study10,02○○○○○ 0,870.866729452491539224331463
Retrieved 1 of 1 entries in 0,8 ms (Link to these results)