Bacterial taxon 243277
Locus VC_2471
Protein NP_232100.1
hypothetical protein
Vibrio cholerae O1 biovar El Tor str. N16961
Length 86 aa, Gene sdhE, UniProt Q9KPA2
>NP_232100.1|Vibrio cholerae O1 biovar El Tor str. N16961|hypothetical protein
MYTAEQKARIKWACRRGMLELDVVIMPFFEECFDSLTESEQDDFVALLESDDPDLFAWVMGHGRCENLGLAAMVDKIVAHNLSKVR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | 1.13 | 6.0e-5 | ○○○○○ 0.93 | 0.9277772820488653 | 24331463 |
Retrieved 1 of 1 entries in 2.5 ms
(Link to these results)