Bacterial taxon 243277
Locus VC_2668
Protein NP_232296.1
hypothetical protein
Vibrio cholerae O1 biovar El Tor str. N16961
Length 146 aa, Gene n/a, UniProt Q9KNR3
>NP_232296.1|Vibrio cholerae O1 biovar El Tor str. N16961|hypothetical protein
MSLQTLLFSFQGRIGRQAFWLWNICYYAMIAGFAMGSNLLFPDVAHLILPVFLLVVLVPDLAITAKRWHDRDKSSWWLLLNVPLVIGRMTIPAGELAVNTQPGMLETLISFVALLCGAWILVECGFLSGTDGSNRFGAEPKWIKKS
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | 1.14 | 0.00012 | ○○○○○ 0.93 | 0.9323499626200634 | 24331463 |
Retrieved 1 of 1 entries in 2.4 ms
(Link to these results)