Bacterial taxon 243277
Locus VC_A0075
Protein NP_232476.1
hypothetical protein
Vibrio cholerae O1 biovar El Tor str. N16961
Length 155 aa, Gene n/a, UniProt Q9KN90
>NP_232476.1|Vibrio cholerae O1 biovar El Tor str. N16961|hypothetical protein
MRWILLILTLWCSSLALASNITIQIADAPPKVFSLQELATELPAVSFTTELPWIHGSHRFTGFKVSDLLEYLQQDHVKSVTFMALNDYAANISIADIQYYEPIVAYYMDGNEMKIRHKGPFWLVYNLDQNPKLKNSVYYTHMVWQISQILIHKKP
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -7.23 | 1.7e-13 | ●●●●● -4.28 | -4.2779168878945795 | 24331463 |
Retrieved 1 of 1 entries in 1.3 ms
(Link to these results)