Bacterial taxon 243277
Locus VC_A0124
Protein NP_232525.1
hypothetical protein
Vibrio cholerae O1 biovar El Tor str. N16961
Length 122 aa, Gene n/a, UniProt Q9KN41
>NP_232525.1|Vibrio cholerae O1 biovar El Tor str. N16961|hypothetical protein
MNNLLSAYVTMLLILLSISGGAIASENCNDTSGVHQKILVCIQNEIAKSETQIRNNISSKSIDYGFPDDFYSKQRLAIHEKCMLYINVGGQRGELLMNQCELSMLQGLDIYIQQYIEDVDNS
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -6.24 | 2.3e-16 | ●●●●○ -3.64 | -3.6441486622313595 | 24331463 |
Retrieved 1 of 1 entries in 1.5 ms
(Link to these results)