Bacterial taxon 243277
Locus VC_A0419
Protein NP_232813.1
hypothetical protein
Vibrio cholerae O1 biovar El Tor str. N16961
Length 261 aa, Gene n/a, UniProt Q9KME2
>NP_232813.1|Vibrio cholerae O1 biovar El Tor str. N16961|hypothetical protein
MQLLWLSLVVMRCQPLRRALALKRKKVIFRTLSILAIIGSVLWFISEPSPEPAVVFVASLAAFFRDEVHGIIGAKFVSLSSRAAPIRDFQHYKYSFVSDNYISPAILDDLNGWVSDVGDQIVSINISDANQSNRYFGKVDTRHVSGTFPVVDYKSDDKYLSYQYVGCSFSGVHILKLVSNYGGSGYFHSLLLVTVMADSCIEFESTSKAIKKERFVIKKVGTIPLGDRYDGTVTYRLGFLTISACKGLKALRTKHERVFIL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -5.85 | 1.2e-8 | ●●●●○ -3.39 | -3.391683236094237 | 24331463 |
Retrieved 1 of 1 entries in 2.2 ms
(Link to these results)