Bacterial taxon 243277
Locus VC_A0431
Protein NP_232825.2
hypothetical protein
Vibrio cholerae O1 biovar El Tor str. N16961
Length 104 aa, Gene n/a, UniProt Q9KMD1
>NP_232825.2|Vibrio cholerae O1 biovar El Tor str. N16961|hypothetical protein
MVNWPCILKLDGDDELVYLGSEADLNCECVDLIVSPSDRVIDSEGFVYSIVSNDSAVSLIGNSTQISAEEASRLIQRHEFCLAEVCLAKIQFETVAEAFNCLKS
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | 1.14 | 0.0089 | ○○○○○ 1.1 | 1.096417467241529 | 24331463 |
Retrieved 1 of 1 entries in 1.9 ms
(Link to these results)