Bacterial taxon 243277
Locus VC_A0487
Protein NP_232879.1
hypothetical protein
Vibrio cholerae O1 biovar El Tor str. N16961
Length 177 aa, Gene n/a, UniProt Q9KM94
>NP_232879.1|Vibrio cholerae O1 biovar El Tor str. N16961|hypothetical protein
MSWGKEFVELSKSKHDRDSFDCGEQELNTFIKTQAAKHMQAGISRTMVLPSAHPLLNQKFAICAFYSVAPSSISRETLPAQLAKKLPRYPIPVFLLAQLAVHKEFHGSGLGKVSLIRALKYLWEVNHHMRAYAIVVDCLTDSAQAFYTKFGFEVLCEHNERIRMFLPMKTVEQLFNQ
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -4.72 | 3.4e-9 | ●●●○○ -2.66 | -2.664825961344736 | 24331463 |
Retrieved 1 of 1 entries in 13.5 ms
(Link to these results)