Bacterial taxon 243277
Locus VC_A0777
Protein NP_233163.1
hypothetical protein
Vibrio cholerae O1 biovar El Tor str. N16961
Length 236 aa, Gene n/a, UniProt Q9KLG7
>NP_233163.1|Vibrio cholerae O1 biovar El Tor str. N16961|hypothetical protein
MSITFEIEPIAEGSILVRFQHPADATLAMHIGQCAHDIMQSLAYGLMNVTPSYTTLLIDYLPYRLTQKELVAQLTLLLNQPRQSNHANANLIELPVYYHPDVGLDLIRYQEQGLALAEVIQLHTSVTYTVAAIGFAPGFAFMTQVAEPLRRPRRTTPRLMLPKGSVGIAEQQTAIYPNASPGGWNIIGNCPQTLFDPRQEPMSPWQIGTQVRFRSIERDEFIQLGGVIEPYSIHRA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -3.39 | 5.1e-9 | ●●○○○ -1.81 | -1.8121287473862098 | 24331463 |
Retrieved 1 of 1 entries in 9.5 ms
(Link to these results)