Bacterial taxon 243277
Locus VC_A0908
Protein NP_233293.2
hypothetical protein
Vibrio cholerae O1 biovar El Tor str. N16961
Length 167 aa, Gene hutX, UniProt Q9KL40
>NP_233293.2|Vibrio cholerae O1 biovar El Tor str. N16961|hypothetical protein
MESLQQQVAQLLEQQPTLLPAAMAEQLNVTEFDIVHALPEEMVAVVDGSHAQTILESLPEWGPVTTIMTIAGSIFEVKAPFPKGKVARGYYNLMGRDGELHGHLKLENISHVALVSKPFMGRESHYFGFFTAQGENAFKIYLGRDEKRELIPEQVARFKAMQQQHKQ
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | 1.44 | 0.0019 | ○○○○○ 1.29 | 1.2910759518982333 | 24331463 |
Retrieved 1 of 1 entries in 15.4 ms
(Link to these results)