Bacterial taxon 243277
Locus VC_0745
Protein NP_230394.2
inositol monophosphatase
Vibrio cholerae O1 biovar El Tor str. N16961
Length 267 aa, Gene n/a, UniProt Q9KTY5
>NP_230394.2|Vibrio cholerae O1 biovar El Tor str. N16961|inositol monophosphatase
MHPMLNIAIRAARKAGNHIAKSLENAEKIQTTQKGSNDFVTNVDKEAEAIIVSTIKSSYPEHCIIAEEGGLIEGKDKEVQWIIDPLDGTTNFVKGFPHFAVSIAVRFRGKTEVACVYDPMTNELFTAQRGAGAQLNNARIRVQPIKDLQGAVLATAFPFKQKQHSESFMKILSAMFVECADFRRTGSAALDLCYLAANRVDGYFELGLKPWDMAAGELIAREAGAIVTDFAGGTDYMQSGNIVASSPRGVKAILQHIRENGNSAILK
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -5.82 | 1.1e-9 | ●●●○○ -2.28 | -2.276846945236025 | 24331463 |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)