Bacterial taxon 243277
Locus VC_A0230
Protein NP_232629.1
iron(III) ABC transporter ATP-binding protein
Vibrio cholerae O1 biovar El Tor str. N16961
Length 254 aa, Gene n/a, UniProt Q9KMT9
>NP_232629.1|Vibrio cholerae O1 biovar El Tor str. N16961|iron(III) ABC transporter ATP-binding protein
MIQLEKLTKHFGTKRVVHDASAQFDKGQVTAIIGPNGAGKSTLLSMASRLVNRDAGKVWIEQRELVEWNTKALAQKLAVLRQSNVLNMRFTVRELTAFGRFPYSQGKLTTQDEQIINQAIEYLDLETIQYQYLDELSGGQRQLAFIAMVMAQDTDYVFLDEPLNNLDIKHSLQIMSTLRRLAHELNKAVVVVIHDINFASCYADKIVALKKGEVVATGSVRDVIQSEVLSAIYDTPFNVIEMQGQRLCLYTLPT
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | 1.58 | 0.0077 | ○○○○○ 1.38 | 1.379348799621982 | 24331463 |
Retrieved 1 of 1 entries in 1.8 ms
(Link to these results)