Bacterial taxon 243277
Locus VC_A0610
Protein NP_232999.1
isoprenoid biosynthesis protein
Vibrio cholerae O1 biovar El Tor str. N16961
Length 216 aa, Gene n/a, UniProt Q9KLY1
>NP_232999.1|Vibrio cholerae O1 biovar El Tor str. N16961|isoprenoid biosynthesis protein
MKKVAVILSGCGVFDGAEIHESVLALHAIEKQGASWHCFAPNVQQMHVINHLTGEEMPETRNVLVESARIARGKIQDVATLNVNEFDALLLPGGFGAAKNLTDFAVKGAQCSINPDVAAACLAFADAQKPAGYICIAPTIIPMIYGEAAQGTIGNDHGTAAAFNQLGGQHVDCPVEGIVFDERHKVLSTPAYMLAENISQAASGIEKLVERLLQLA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -4.65 | 1.8e-9 | ●●●○○ -2.62 | -2.620357472199333 | 24331463 |
Retrieved 1 of 1 entries in 152.2 ms
(Link to these results)