Bacterial taxon 243277
Locus VC_1904
Protein NP_231538.1
leucine-responsive transcriptional regulator
Vibrio cholerae O1 biovar El Tor str. N16961
Length 164 aa, Gene n/a, UniProt Q9KQU4
>NP_231538.1|Vibrio cholerae O1 biovar El Tor str. N16961|leucine-responsive transcriptional regulator
MVDSYKKPSKDLDRIDRNILNELQKDGRISNVELSKRVGLSPTPCLERVRRLERQGFITGYTALLNPQYLDASLLVFVEITLNRGAPDVFEQFNAAVQKLDDIQECHLVSGDFDYLLKTRVSDMGAYRRLLGDTLLRLPGVNDTRTYVVMEEVKQTNQLVIKTR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -7.98 | 4.0e-13 | ●●●●○ -3.28 | -3.275780529506864 | 24331463 |
Retrieved 1 of 1 entries in 69.5 ms
(Link to these results)