Bacterial taxon 243277
Locus VC_0213
Protein NP_229870.1
lipid A biosynthesis lauroyl acyltransferase
Vibrio cholerae O1 biovar El Tor str. N16961
Length 318 aa, Gene lpxL, UniProt Q9KVD3
>NP_229870.1|Vibrio cholerae O1 biovar El Tor str. N16961|lipid A biosynthesis lauroyl acyltransferase
MSTMSQDKYSKPEFSFSLLHPKYWGVWLGFGLLALLVNLLPYPVLLKIGRGLGQFSMRFGKKRVHIARRNLELAFPTMSQSEIDAFVLENFKNTGAALIETGITWFWPTWRFKRILIDKDTQAIRQHAKTGQGVLLCCVHALNLEITARAFAVLGIGGYGVYRPHSNPAYEFIQYRGRTRNGNQLINRTDIKQMIRVLRQGERLFYLPDQDYGHNKSVFVPFFAVEEACTTTGTSILAYTSHCAIVIGSGFRNAQGRYEIMADKSIEADYPQKDETAAAAYMNKFVEEIILRAPEQWMWLHKRFKSLPDYELTNSRYQ
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -3.09 | 7.3e-6 | ●●○○○ -1.02 | -1.021466447929677 | 24331463 |
Retrieved 1 of 1 entries in 1.3 ms
(Link to these results)