Bacterial taxon 243277
Locus VC_0944
Protein NP_230591.1
lipoate-protein ligase B
Vibrio cholerae O1 biovar El Tor str. N16961
Length 219 aa, Gene lipB, UniProt Q9KTF8
>NP_230591.1|Vibrio cholerae O1 biovar El Tor str. N16961|lipoate-protein ligase B
MTIMENQLLVRRLGRQDYTPVWQAMHQFTDQRDSTTRDEVWLVEHNPVFTQGQAGKAEHLLNTGDIPVVQSDRGGQVTYHGPGQLVAYFLIDLRRKKLGVRELVTHIENLVIHTLKHYQIESAARPDAPGVYVKNRKICSLGLRIRKGCSFHGLALNIQMDLAPFLRINPCGYAGMEMIQVSDLHPVSMEQVEKVLIQELVTLLDYEQVEFSTEAYNHE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -4 | 5.1e-8 | ●●○○○ -1.44 | -1.439391832661411 | 24331463 |
Retrieved 1 of 1 entries in 8.7 ms
(Link to these results)