Bacterial taxon 243277
Locus VC_0247
Protein NP_229904.1
lipopolysaccharide/O-antigen transport protein
Vibrio cholerae O1 biovar El Tor str. N16961
Length 271 aa, Gene n/a, UniProt Q9KVA2
>NP_229904.1|Vibrio cholerae O1 biovar El Tor str. N16961|lipopolysaccharide/O-antigen transport protein
MVWSATSRTKYSIKKSFFGCSMIELSNVNLHYPVPGHFSHSLQTTISSKIGGVLGSSSAKDKEMKYVHALRDINLKLEDSSRLGIIGHNGAGKTTLLRLLSQVYPPTSGKVTIEGKISALTDFTLGMDPNATGLKNIEFRLVFMGCTFKEAQQAVEEIVAFSELGEFINLPVRTYSTGMFLRLAFAISTHFTPDILILDEVIGAGDETFREKALSRLESLIKKSRMVVLSSHDLNAIKQYCDQAIVMEKGEIVFNGTPQSCIDYYLNSVKK
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -6.38 | 1.7e-9 | ●●●○○ -2.54 | -2.5380010514665416 | 24331463 |
Retrieved 1 of 1 entries in 2.2 ms
(Link to these results)