Bacterial taxon 243277
Locus VC_A0059
Protein NP_232460.2
major outer membrane lipoprotein
Vibrio cholerae O1 biovar El Tor str. N16961
Length 82 aa, Gene n/a, UniProt Q9KNA6
>NP_232460.2|Vibrio cholerae O1 biovar El Tor str. N16961|major outer membrane lipoprotein
MNKMLIAAAASSVLLLAGCASGPDEATTAKMNEISTQVSELNSQVAALASKVDQAAEAAKAAQEEAARANERIDNIAQSYTK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | 4.59 | 0.0031 | ○○○○○ 3.31 | 3.308876196395359 | 24331463 |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)