Bacterial taxon 243277
Locus VC_A0152
Protein NP_232552.1
monovalent cation/H+ antiporter subunit G
Vibrio cholerae O1 biovar El Tor str. N16961
Length 107 aa, Gene n/a, UniProt Q9KN14
>NP_232552.1|Vibrio cholerae O1 biovar El Tor str. N16961|monovalent cation/H+ antiporter subunit G
MSMLAALLLVLGTLFTLFASLGILRMPDLYTRMHAATKAGTAGLSLLLLAVALCMPEIGVISRLVGIMLFIFLTAPVAAHLLGKVTQQAGYAFWRNQDAAKQKKAQK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -4.69 | 5.6e-8 | ●●●○○ -2.65 | -2.648453978910129 | 24331463 |
Retrieved 1 of 1 entries in 34.6 ms
(Link to these results)