Bacterial taxon 243277
Locus VC_A0313
Protein NP_232709.1
MutT/nudix family protein
Vibrio cholerae O1 biovar El Tor str. N16961
Length 128 aa, Gene n/a, UniProt Q9KMM0
>NP_232709.1|Vibrio cholerae O1 biovar El Tor str. N16961|MutT/nudix family protein
MNHLAMAVVIKNNLVLVQKRFRKNTGMIFEFPGGSIDAGESGEQAAIRELWEETGLRNLKLIGTHKSINENGGDIYHVVFSASMDAEPKEIEPYRQQTFYWFEASQIPLNDFYSADVNFIKEHLGSYT
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | 2.31 | 0.00026 | ○○○○○ 1.84 | 1.8440132261052498 | 24331463 |
Retrieved 1 of 1 entries in 13.9 ms
(Link to these results)