Bacterial taxon 243277
Locus VC_A0764
Protein NP_233150.1
MutT/nudix family protein
Vibrio cholerae O1 biovar El Tor str. N16961
Length 185 aa, Gene n/a, UniProt Q9KLI0
>NP_233150.1|Vibrio cholerae O1 biovar El Tor str. N16961|MutT/nudix family protein
MTPSSPLYFDKTHSMSKIIHQWKSIALVEEDVLLPNGHSVTHTTISHPGAAVILPLTDQGEIVVIRQFRPSLKKWLLELPAGTIEEGEPPLSCAQRELEEETGFSAQQFIELGQVTPLAGFCDEIQHLFVAKNLSKTARYSCDEDEVIEVLFLTPQELERKIVFGDITDSKTIACLSKAKLCGYL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -2.32 | 1.9e-5 | ●●○○○ -1.13 | -1.1267204790227694 | 24331463 |
Retrieved 1 of 1 entries in 1.6 ms
(Link to these results)