Bacterial taxon 243277
Locus VC_2239
Protein NP_231870.1
nitrogen regulatory protein P-II
Vibrio cholerae O1 biovar El Tor str. N16961
Length 114 aa, Gene n/a, UniProt Q9KPX3
>NP_231870.1|Vibrio cholerae O1 biovar El Tor str. N16961|nitrogen regulatory protein P-II
MNMKKIEAIIKPFKLDDVREALAEVGITGMTVSEVKGFGRQKGHTELYRGAEYMVDFLPKVKLEIVVTDDVADRCVDTIIETAQTGKIGDGKIFITNVERVVRIRTGEEDEDAI
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | 1.15 | 0.0045 | ○○○○○ 0.94 | 0.935671401071231 | 24331463 |
Retrieved 1 of 1 entries in 1.9 ms
(Link to these results)