Bacterial taxon 243277
Locus VC_1987
Protein NP_231621.1
outer membrane lipoprotein Slp
Vibrio cholerae O1 biovar El Tor str. N16961
Length 202 aa, Gene n/a, UniProt Q9KQL1
>NP_231621.1|Vibrio cholerae O1 biovar El Tor str. N16961|outer membrane lipoprotein Slp
MRSYLGSISTSKTEVNSMKMHVLKLLIPTMALLLSACASLPPELGNPDDKSVVTQYSAWLERDPATQSPVRMGGVVANISNQKDRTRVELVNLPIDSAGRPNIHQEPQGRFVAYVPGFLDPITYGEGRLLTLYGTTAPSEQGKVGDYEHTYPVMNAQGYHLWRVEERVEVDDIGPYMFPCRGFYCWPRTMPERDGKIIQEVK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -2.86 | 2.3e-7 | ●○○○○ -0.92 | -0.91623611369078 | 24331463 |
Retrieved 1 of 1 entries in 1.3 ms
(Link to these results)