Bacterial taxon 243277
Locus VC_0046
Protein NP_229705.1
peptide deformylase
Vibrio cholerae O1 biovar El Tor str. N16961
Length 169 aa, Gene def1, UniProt Q9KVU3
>NP_229705.1|Vibrio cholerae O1 biovar El Tor str. N16961|peptide deformylase
MSVLQVLTFPDDRLRTVAKPVEQVTPEIQQIVDDMLETMYAEEGIGLAATQVDIHQRIVVIDISETRDQPMVLINPEIIEKRGEDGIEEGCLSVPGARALVPRAAEVTVKALDRNGQEYQFDADDLLAICVQHELDHLAGKLFVDYLSPLKRNRIKEKLEKIKRFNEKK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | 4.31 | 0.012 | ○○○○○ 2.39 | 2.394138301930297 | 24331463 |
Retrieved 1 of 1 entries in 21.1 ms
(Link to these results)