Bacterial taxon 243277
Locus VC_0983
Protein NP_230629.1
regulatory protein ToxS
Vibrio cholerae O1 biovar El Tor str. N16961
Length 173 aa, Gene toxS, UniProt P24003
>NP_230629.1|Vibrio cholerae O1 biovar El Tor str. N16961|regulatory protein ToxS
MQNRHIAMGILLLSLLLSSWLYWGSDFKLEQVLTSREWQSKMVSLIKTNSNRPAMGPLSRVDVTSNVKYLPNGTYLRVSIVKLFSDDNSAESVINISEFGEWDISDNYLLVTPVEFKDISSNQSKDFTDEQLQLITQLFKMDAQQSRRVDIVNERTILFTSLSHGSTVLFSNS
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -2.9 | 2.7e-6 | ●○○○○ -0.93 | -0.933583252767775 | 24331463 |
Retrieved 1 of 1 entries in 0.6 ms
(Link to these results)