Bacterial taxon 243277
Locus VC_1155
Protein NP_230800.1
response regulator
Vibrio cholerae O1 biovar El Tor str. N16961
Length 181 aa, Gene n/a, UniProt Q9KSV1
>NP_230800.1|Vibrio cholerae O1 biovar El Tor str. N16961|response regulator
MAAFNGIRTHLGKEQAMNKFLILCVDDEREVLDSVVQDLDCFEEHFIIEAAESVAEAKSVIEDYRQEAIPLALILCDHIMPEQTGIQFLIELNQEADTTRTRKMLLTGQAGLEDTVQAVNHASLHFYIAKPWHGEQLRQAVKEQLTHYVIENEEDLMPWIQILDAEKILNAIAAKRMSFGE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -3.11 | 3.9e-7 | ●●○○○ -1.03 | -1.0284272585019454 | 24331463 |
Retrieved 1 of 1 entries in 1.5 ms
(Link to these results)