Bacterial taxon 243277
Locus VC_2234
Protein NP_231865.1
ribonuclease H
Vibrio cholerae O1 biovar El Tor str. N16961
Length 156 aa, Gene rnhA, UniProt Q9KPX8
>NP_231865.1|Vibrio cholerae O1 biovar El Tor str. N16961|ribonuclease H
MNKQVEIFTDGSCLGNPGPGGYGIVMRYKQVEKTLARGYRLTTNNRMEMLAAVMALQALKEPCRVILTTDSQYVRQGITQWIHNWKLRGWKTADKKPVKNADLWQALDKETARHQVEWRWVKGHAGHRENEMCDELARQAAENPTEDDIGYQPEPQ
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -6.7 | 1.1e-14 | ●●●○○ -2.68 | -2.684378890870733 | 24331463 |
Retrieved 1 of 1 entries in 1.4 ms
(Link to these results)