Bacterial taxon 243277
Locus VC_1045
Protein NP_230690.1
RNA polymerase sigma factor
Vibrio cholerae O1 biovar El Tor str. N16961
Length 188 aa, Gene n/a, UniProt Q9KT60
>NP_230690.1|Vibrio cholerae O1 biovar El Tor str. N16961|RNA polymerase sigma factor
MVSILNLFGKKVSQRPVNNDMDRQRKYEALVRAYHRDLYRYAYWLCKDRSIAEDLVQETCLRAWKSLDSLLDEKAAKAWLITILRRENARRFERKQFDLVDIDDHDYEAKYSDDEHHQNEWLQRQILKLDVEYRELLFLQVVGGFSGEEIADILSLNKNTVMTRLFRARNQLKEMMDGSEHYPEQQNG
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | 0.82 | 0.0017 | ○○○○○ 0.78 | 0.7845148697255182 | 24331463 |
Retrieved 1 of 1 entries in 9.8 ms
(Link to these results)