Bacterial taxon 243277
Locus VC_1960
Protein NP_231594.1
septum site-determining protein MinD
Vibrio cholerae O1 biovar El Tor str. N16961
Length 276 aa, Gene n/a, UniProt Q9KQN8
>NP_231594.1|Vibrio cholerae O1 biovar El Tor str. N16961|septum site-determining protein MinD
MKGKNNMSRIIVVTSGKGGVGKTTSSAAIASGLALRGKKTAVIDFDIGLRNLDLIMGCERRVVYDFVNVINGEATLNQALIKDKRNENLFILPASQTRDKDALTKDGVQRVLNDLKEMGFDFIICDSPAGIEQGALMALYYADEAIVTTNPEVSSVRDSDRILGILDSKSMRAEQGQAPIKQHLLLTRYNPARVTQGEMLSVQDVEEILHVPLLGVIPESQAVLNASNKGVPVIFDDQSDAGQAYQDTVARLLGEQVEFRFLTEAKKGIFKRLFGG
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | 0.56 | 0.026 | ○○○○○ 0.66 | 0.6649289946362914 | 24331463 |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)