Bacterial taxon 243277
Locus VC_1591
Protein NP_231231.1
short chain dehydrogenase/reductase family oxidoreductase
Vibrio cholerae O1 biovar El Tor str. N16961
Length 252 aa, Gene n/a, UniProt Q9KRP5
>NP_231231.1|Vibrio cholerae O1 biovar El Tor str. N16961|short chain dehydrogenase/reductase family oxidoreductase
MRGLTHKVALVTGAANGIGLAIAERLYQEGATLALADWNEEQLAIVIEQFDSARVYAQKVDVSDPEQVQALVRKTVERFGRLDILVNNAGIHIPGTVLECSVQDWRRIASVNIDGVVYCAMHALPELIKTRGCMVNTASVSGLGGDWGAAFYCATKGAVVNFTRALALDHGAQGVRINAVCPSLVKTNMTNGWPQAIRDQFNERIALGRAAEPKEIAAVVAFLASDDASFVHGVNLPVDGGATASDGQPKIV
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -3.16 | 1.0e-6 | ●●○○○ -1.05 | -1.0522960051743309 | 24331463 |
Retrieved 1 of 1 entries in 1.4 ms
(Link to these results)