Bacterial taxon 243277
Locus VC_A0198
Protein NP_232598.1
site-specific DNA-methyltransferase
Vibrio cholerae O1 biovar El Tor str. N16961
Length 383 aa, Gene n/a, UniProt Q9KMW8
>NP_232598.1|Vibrio cholerae O1 biovar El Tor str. N16961|site-specific DNA-methyltransferase
MITLTVWAFNLFSPSKPIIFSFFAGSGFLDLGFETSGFDVRFVNEFHKPFLDAYKYSREHMGLPKPKYGHYLGSIDDFVTGEKKQLLYDLVQEAKSEALTGFIGGPPCPDFSVAGKNKGSDGENGILTRVYIDAIVQNQPDFFLFENVKGLWKTGKHRAFYDAMKAHLEDAGYVLTDRLTNSIEFGVPQDRDRILMFGIHRKHVGDKLTSIELARDFDWEREVKFDKTKVLDKSIWPELATYKENSIRKLPKHLDNYRELTVEHWFQKNDVNQHLNAKHHFRPYSDKFKTIQEGDDKKKSFKRLHRYRFSPTAAYGNNEVHLHPYKPRRLSAAEALAIQSLPKEFHLPPTMTLSDMFKTIGNGVPFLASKCIAQTIHNYLESL
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -2.04 | 0.0036 | ●○○○○ -0.94 | -0.9439618717658051 | 24331463 |
Retrieved 1 of 1 entries in 1.3 ms
(Link to these results)