Bacterial taxon 243277
Locus VC_A0291
Protein NP_232687.1
site-specific recombinase IntI4
Vibrio cholerae O1 biovar El Tor str. N16961
Length 320 aa, Gene n/a, UniProt H9L4R7
>NP_232687.1|Vibrio cholerae O1 biovar El Tor str. N16961|site-specific recombinase IntI4
MKSQFLLSVREFMQTRYYAKKTIEAYLHWITRYIHFHNKKHPSLMGDKEVEEFLTYLAVQGKVATKTQSLALNSLSFLYKEILKTPLSLEIRFQRSQLERKLPVVLTRDEIRRLLEIVDPKHQLPIKLLYGSGLRLMECMRLRVQDIDFDYGAIRIWQGKGGKNRTVTLAKELYPHLKEQIALAKRYYDRDLHQKNYGGVWLPTALKEKYPNAPYEFRWHYLFPSFQLSLDPESDVMRRHHMNETVLQKAVRRSAQEAGIEKTVTCHTLRHSFATHLLEVGADIRTVQEQLGHTDVKTTQIYTHVLDRGASGVLSPLSRL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -6.8 | 3.4e-7 | ●●●●● -4 | -4.000742689614697 | 24331463 |
Retrieved 1 of 1 entries in 2.6 ms
(Link to these results)