Bacterial taxon 243277
Locus VC_1008
Protein NP_230654.1
sodium-type flagellar protein MotY
Vibrio cholerae O1 biovar El Tor str. N16961
Length 294 aa, Gene n/a, UniProt Q9KT95
>NP_230654.1|Vibrio cholerae O1 biovar El Tor str. N16961|sodium-type flagellar protein MotY
MNKWVITSLFAISTLSASVASALEVRYMATPQQSTWQMATNTPLECRLVHPIPNYGDAEFSSRAGKKINLDFELKMRRPMGDTRNVSLVSMPPVWRPGEGADRITNLQFFKQFDGYIGGQTAWSLLSELEKGRYPTFSYQDWQSRDQRIEVALSSVLFQQPYNEFSDCISKLLPYSFEDISFTILHYDQGTSVELNKASQKRLAQIAEYVRYNQDIDLVLVSTYTDSTDTNNNSQNLSEQRAEVLREYFKSIGLPEDRIQVQGYGKRRPIADNASPIGKDKNRRVVISLGRTQV
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | 2.5 | 8.2e-5 | ○○○○○ 1.56 | 1.5559371927119983 | 24331463 |
Retrieved 1 of 1 entries in 1.4 ms
(Link to these results)