Bacterial taxon 243277
Locus VC_1427
Protein NP_231070.1
spermidine/putrescine ABC transporter membrane protein
Vibrio cholerae O1 biovar El Tor str. N16961
Length 286 aa, Gene n/a, UniProt Q9KS34
>NP_231070.1|Vibrio cholerae O1 biovar El Tor str. N16961|spermidine/putrescine ABC transporter membrane protein
MMSKKLNLQNAIVTLIVGWLVLFVLIPNLMIIGTSFLTRDEANLIKFAFTFENYTRLLDPLYGKVMLHSFYMAIVATLICLVIGYPFAYIVAKMPEKWRPFMLFLIIVPFWTNSLIRTYGLKIVLGTQGILNQALMSLGLIDAPLRIMFTETAVMIGLVYILLPFMILPLYSAIEKLDGTYIEAARDLGANKFQTLVRVILPLTMPGIIGGCLLVLLPALGMFYIADLLGGAKNLLIGNVIKSQVLNARDWPFGAATSIALTLAMAIMLYAYYRAGKLLNKKVELD
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | 0.6 | 0.00074 | ○○○○○ 0.68 | 0.6835167368204845 | 24331463 |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)