Bacterial taxon 243277
Locus VC_2045
Protein NP_231679.1
superoxide dismutase
Vibrio cholerae O1 biovar El Tor str. N16961
Length 194 aa, Gene n/a, UniProt Q9KQF3
>NP_231679.1|Vibrio cholerae O1 biovar El Tor str. N16961|superoxide dismutase
MAFELPALPYAKDALEPHISAETLDFHHGKHHNTYVVKLNGLIPGTEFENKSLEEIIKTSTGGIFNNAAQVWNHTFYWHCLSPNGGGEPTGAVAEAINAAFGSFADFKAKFTDSAINNFGSSWTWLVKKADGTLAITNTSNAATPLTEEGVTPLLTVDLWEHAYYIDYRNVRPDYMNGFWALVNWDFVAQNLAK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -7.27 | 4.9e-12 | ●●●○○ -2.95 | -2.9464055007132206 | 24331463 |
Retrieved 1 of 1 entries in 18.7 ms
(Link to these results)