Bacterial taxon 243277
Locus VC_A1111
Protein NP_233490.1
thermostable hemolysin
Vibrio cholerae O1 biovar El Tor str. N16961
Length 200 aa, Gene n/a, UniProt H9L4P9
>NP_233490.1|Vibrio cholerae O1 biovar El Tor str. N16961|thermostable hemolysin
MKPLPCLADLTLEVITPTHPRWNEAIKLVDERYQQAFDAHLTAYMPAYLALLDKQVMKSVCGYRIAEQEPLFLEQYLDEPADRLLAQRFACPIPRGKLIEFGHLASFGRGLSAFHFRLMAQQLVAMGFEWCIFTATDPLHALMRRFGLQLTLIAQASPARIPNASQIWGTYYQHRPRILAGNLVHGCTHLNQLHLNQKQA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -4.22 | 1.0e-9 | ●●●○○ -2.34 | -2.3448827527927847 | 24331463 |
Retrieved 1 of 1 entries in 24.6 ms
(Link to these results)