Bacterial taxon 243277
Locus VC_0034
Protein NP_229693.1
thiol:disulfide interchange protein
Vibrio cholerae O1 biovar El Tor str. N16961
Length 200 aa, Gene dsbA, UniProt P32557
>NP_229693.1|Vibrio cholerae O1 biovar El Tor str. N16961|thiol:disulfide interchange protein
MKKLFALVATLMLSVSAYAAQFKEGEHYQVLKTPASSSPVVNEFFSFYCPHCNTFEPIIAQLKQQLPEGAKFQKNHVSFMGGNMGQAMSKAYATMIALEVEDKMVPVMFNRIHTLRKPPKDEQELRQIFLDEGIDAAKFDAAYNGFAVDSMVRRFDKQFQDSGLTGVPAVVVNNRYLVQGQSVKSLDEYFDLVNYLLTLK
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -7.74 | 9.2e-13 | ●●●●○ -3.16 | -3.164508422823242 | 24331463 |
Retrieved 1 of 1 entries in 0.5 ms
(Link to these results)