Bacterial taxon 243277
Locus VC_0833
Protein NP_230481.1
toxin co-regulated pilus biosynthesis protein D
Vibrio cholerae O1 biovar El Tor str. N16961
Length 278 aa, Gene tcpD, UniProt P29491
>NP_230481.1|Vibrio cholerae O1 biovar El Tor str. N16961|toxin co-regulated pilus biosynthesis protein D
MVNVIMKISSLKKGSNFSINIKNIKLDKKLLVAIIFLVLSILGGGAYLYYENEKTKKLEQARLQKIQKENSDKQTYLSDFKSAFEGLDYQALTGFYDVLRSDIDFFRVNNWLLDVMDCNVNCNLAFKRGSFDTFTYLEMNRNGAVIKPQFDQNKLQFANVDYISGFRSIYLKDLTEQERDKSENIIEQCSTKLSELYNLQLLMKEQVKFKINLPRNVTSISGYDWVKNSDIKFGSIEIENMPEKNLGLMKNIMNNSMMITSISLQNSSFKSKLNYYCY
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -10.47 | 2.3e-7 | ●●●●● -4.42 | -4.423530306371217 | 24331463 |
Retrieved 1 of 1 entries in 2.5 ms
(Link to these results)