Bacterial taxon 243277   Locus VC_1118   Protein NP_230763.1

transcriptional regulator

Vibrio cholerae O1 biovar El Tor str. N16961

Length 142 aa, Gene n/a, UniProt Q9KSY8

>NP_230763.1|Vibrio cholerae O1 biovar El Tor str. N16961|transcriptional regulator
MSIMDVQHVAQFYQQLDKSQLHRLIEIYHPDVVFEDAAHRIEGFDALYQYFLNLYQNVHTCTFTIHEQYAVNEGAFLVWTMHLRHPKLAKGEQVDVKGVSHLHFAEGKVTYHRDYFDMGEMLYEQLPVLGQVIRAIKRRLGQ

 

Show protein visualisation   Find similar proteins   Download Table  
Host Tissue    Time Post Infection Transposon Insertion Site Raw Fitness Score    p-Value    Fitness z-Score Reference  
Rabbit (Oryctolagus cuniculus)small intestine BTO:000065118 hnot available in this study-3,091,8e-6●●○○○ -1,02-1.021880759283433824331463
Retrieved 1 of 1 entries in 0,8 ms (Link to these results)