Bacterial taxon 243277
Locus VC_A0247
Protein NP_232645.1
transcriptional repressor UlaR
Vibrio cholerae O1 biovar El Tor str. N16961
Length 251 aa, Gene n/a, UniProt Q9KMS3
>NP_232645.1|Vibrio cholerae O1 biovar El Tor str. N16961|transcriptional repressor UlaR
MNEVQRHNGILSLLEENQAINVSHIIERFNVSPATARRDIAKLDELGKLRKVRNGAERIENQKRKWSPLNINSTEHYEEKSLIALKAAELCQPGDSVVINCGSTAFLLGQQLCGENVQIVTNYFPLASYLINEDHDDVIIIGGQYNRAQSIFLNPAPDSLGGYAGNWMFTSGKGLTEAGLYKTDMLTAVAEQQMLEQIDKLVVVVDSSKVGQRTGMLFCSTSKIDIVITGKNANAEVVKAIEAQGTQVILV
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -6.4 | 1.1e-9 | ●●●●○ -3.74 | -3.74267733390941 | 24331463 |
Retrieved 1 of 1 entries in 1.6 ms
(Link to these results)