Bacterial taxon 243277
Locus VC_0086
Protein NP_229745.1
twin-arginine translocation protein TatA
Vibrio cholerae O1 biovar El Tor str. N16961
Length 82 aa, Gene tatA, UniProt P57051
>NP_229745.1|Vibrio cholerae O1 biovar El Tor str. N16961|twin-arginine translocation protein TatA
MGGISIWQLLIIAVIVVLLFGTKKLRGIGSDLGSAVKGFKKAMSEEESNSAANQKDADFETKNLEQAKTNASAEVKKDKEQA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -2.83 | 2.3e-7 | ●○○○○ -0.9 | -0.9002374444448534 | 24331463 |
Retrieved 1 of 1 entries in 1.5 ms
(Link to these results)