Bacterial taxon 243277
Locus VC_2277
Protein NP_231908.1
xanthine-guanine phosphoribosyltransferase
Vibrio cholerae O1 biovar El Tor str. N16961
Length 154 aa, Gene gpt, UniProt Q9KPT5
>NP_231908.1|Vibrio cholerae O1 biovar El Tor str. N16961|xanthine-guanine phosphoribosyltransferase
MSKKFVITWDNMQHYCRELAQRQMPAEQWKGILGVSRGGLVPAAILARELGIRYVDTVCISSYDHDHQRDMTVLKAPEHDGEGFLIIDDLVDSGDTARKIREMYPKAKFVTVCAKPAGKDLVDEYVVDIPQDTWIEQPWDMVLSYVEPVNRKQK
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | 1.46 | 0.048 | ○○○○○ 1.08 | 1.0777075180170048 | 24331463 |
Retrieved 1 of 1 entries in 1.4 ms
(Link to these results)