Bacterial taxon 243277
Locus VC_2082
Protein NP_231714.1
zinc ABC transporter ATP-binding protein
Vibrio cholerae O1 biovar El Tor str. N16961
Length 262 aa, Gene znuC, UniProt Q9KQB8
>NP_231714.1|Vibrio cholerae O1 biovar El Tor str. N16961|zinc ABC transporter ATP-binding protein
MAILIELQDICVDFEQRRVLDNIRLTLTKGNITTLIGPNGAGKSTLVKVILGLQSLSSGKIIRQSGIRIGYVPQKLKLNDTLPLTVNRFLKLAGRFSTQELSEALRLVGGEHLQSSDMHKLSGGETQRVLLARALLQRPDLLVLDEPAQGVDVQGQIDLYDLIHTLRNRFGCAVLMVSHDLHLVMAKTDEVICLQHHVCCSGSPESIAKHPSYLAMFGHRSRDTLAFYQHHHEHHHHDLSGLPVKGKASVCSHHSHGHHKHD
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -2.84 | 1.5e-8 | ●○○○○ -0.9 | -0.903243929048672 | 24331463 |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)